Lineage for d4qnsd_ (4qns D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731925Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries)
  8. 1731929Domain d4qnsd_: 4qns D: [263775]
    automated match to d4qnsa_
    complexed with act, edo, so4

Details for d4qnsd_

PDB Entry: 4qns (more details), 1.5 Å

PDB Description: crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
PDB Compounds: (D:) Histone acetyltransferase GCN5, putative

SCOPe Domain Sequences for d4qnsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnsd_ a.29.2.0 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
vqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdyktk
edfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

SCOPe Domain Coordinates for d4qnsd_:

Click to download the PDB-style file with coordinates for d4qnsd_.
(The format of our PDB-style files is described here.)

Timeline for d4qnsd_: