Lineage for d1fq3b_ (1fq3 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60625Protein Granzyme B [50590] (2 species)
  7. 60626Species Human (Homo sapiens) [TaxId:9606] [50592] (2 PDB entries)
  8. 60629Domain d1fq3b_: 1fq3 B: [26377]

Details for d1fq3b_

PDB Entry: 1fq3 (more details), 3.1 Å

PDB Description: crystal structure of human granzyme b

SCOP Domain Sequences for d1fq3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq3b_ b.47.1.2 (B:) Granzyme B {Human (Homo sapiens)}
iiggheakphsrpymaylmiwdqkslkrcggfliqddfvltaahcwgssinvtlgahnik
eqeptqqfipvkrpiphpaynpknfsndimllqlerkakrtravqplrlpsnkaqvkpgq
tcsvagwgqtaplgkhshtlqevkmtvqedrkcesdlrhyydstielcvgdpeikktsfk
gdsggplvcnkvaqgivsygrnngmppractkvssfvhwikktmkry

SCOP Domain Coordinates for d1fq3b_:

Click to download the PDB-style file with coordinates for d1fq3b_.
(The format of our PDB-style files is described here.)

Timeline for d1fq3b_: