Lineage for d4qm1d1 (4qm1 D:1-479)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080705Species Bacillus anthracis [TaxId:198094] [228249] (8 PDB entries)
  8. 2080739Domain d4qm1d1: 4qm1 D:1-479 [263766]
    Other proteins in same PDB: d4qm1a2, d4qm1b2, d4qm1c2, d4qm1d2
    automated match to d4qm1b_
    complexed with 39h, imp

Details for d4qm1d1

PDB Entry: 4qm1 (more details), 2.8 Å

PDB Description: crystal structure of the inosine 5'-monophosphate dehydrogenase with an internal deletion of the cbs domain from bacillus anthracis str. ames complexed with inhibitor d67
PDB Compounds: (D:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d4qm1d1:

Sequence, based on SEQRES records: (download)

>d4qm1d1 c.1.5.0 (D:1-479) automated matches {Bacillus anthracis [TaxId: 198094]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp
ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqit

Sequence, based on observed residues (ATOM records): (download)

>d4qm1d1 c.1.5.0 (D:1-479) automated matches {Bacillus anthracis [TaxId: 198094]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamelvpegiegrvpykgpladtvhqlvgglra
gmgycgaqdleflrenaqfirmsgagllesvqit

SCOPe Domain Coordinates for d4qm1d1:

Click to download the PDB-style file with coordinates for d4qm1d1.
(The format of our PDB-style files is described here.)

Timeline for d4qm1d1:

  • d4qm1d1 first appeared in SCOPe 2.05, called d4qm1d_