Lineage for d4qm0c1 (4qm0 C:265-507)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2009679Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2009680Protein automated matches [191142] (6 species)
    not a true protein
  7. 2009693Species Human (Homo sapiens) [TaxId:9606] [189274] (53 PDB entries)
  8. 2009702Domain d4qm0c1: 4qm0 C:265-507 [263764]
    Other proteins in same PDB: d4qm0c2
    automated match to d3l0la_
    complexed with 39k, dms

Details for d4qm0c1

PDB Entry: 4qm0 (more details), 2.19 Å

PDB Description: Crystal structure of RORc in complex with a tertiary sulfonamide inverse agonist
PDB Compounds: (C:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4qm0c1:

Sequence, based on SEQRES records: (download)

>d4qm0c1 a.123.1.0 (C:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs

Sequence, based on observed residues (ATOM records): (download)

>d4qm0c1 a.123.1.0 (C:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqqaafpplykelfs

SCOPe Domain Coordinates for d4qm0c1:

Click to download the PDB-style file with coordinates for d4qm0c1.
(The format of our PDB-style files is described here.)

Timeline for d4qm0c1:

  • d4qm0c1 first appeared in SCOPe 2.05, called d4qm0c_

View in 3D
Domains from same chain:
(mouse over for more information)
d4qm0c2
View in 3D
Domains from other chains:
(mouse over for more information)
d4qm0a_