Lineage for d1fi8b_ (1fi8 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795608Protein Granzyme B [50590] (2 species)
  7. 2795613Species Norway rat (Rattus norvegicus) [TaxId:10116] [50591] (1 PDB entry)
  8. 2795615Domain d1fi8b_: 1fi8 B: [26375]
    Other proteins in same PDB: d1fi8.1, d1fi8.2

Details for d1fi8b_

PDB Entry: 1fi8 (more details), 2.2 Å

PDB Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
PDB Compounds: (B:) natural killer cell protease 1

SCOPe Domain Sequences for d1fi8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi8b_ b.47.1.2 (B:) Granzyme B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk

SCOPe Domain Coordinates for d1fi8b_:

Click to download the PDB-style file with coordinates for d1fi8b_.
(The format of our PDB-style files is described here.)

Timeline for d1fi8b_: