Lineage for d1fi8a_ (1fi8 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15103Protein Granzyme B [50590] (2 species)
  7. 15107Species Rat (Rattus norvegicus) [TaxId:10116] [50591] (1 PDB entry)
  8. 15108Domain d1fi8a_: 1fi8 A: [26374]
    Other proteins in same PDB: d1fi8.1, d1fi8.2

Details for d1fi8a_

PDB Entry: 1fi8 (more details), 2.2 Å

PDB Description: rat granzyme b [n66q] complexed to ecotin [81-84 iepd]
PDB Compounds: (A:)

SCOP Domain Sequences for d1fi8a_:

Sequence, based on SEQRES records: (download)

>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus)}
iiggheakphsrpymaylqimdeysgskkcggfliredfvltaahcsgskiqvtlgahni
keqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpg
dvcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasf
rgdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk

Sequence, based on observed residues (ATOM records): (download)

>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus)}
iiggheakphsrpymaylqimdeysskkcggfliredfvltaahcsgskiqvtlgahnik
eqekmqqiipvvkiiphpaynsktisndimllklkskakrssavkplnlprrnvkvkpgd
vcyvagwgklgpmgkysdtlqeveltvqedqkcesylknyfdkaneicagdpkikrasfr
gdsggplvckkvaagivsygqndgstpraftkvstflswikktmkk

SCOP Domain Coordinates for d1fi8a_:

Click to download the PDB-style file with coordinates for d1fi8a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi8a_: