![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (2 families) ![]() automatically mapped to Pfam PF09298 |
![]() | Family b.34.8.0: automated matches [257687] (1 protein) not a true family |
![]() | Protein automated matches [257688] (2 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [257689] (1 PDB entry) |
![]() | Domain d4qkud1: 4qku D:7-133 [263725] Other proteins in same PDB: d4qkua2, d4qkub2, d4qkuc2, d4qkud2 automated match to d4qkua1 complexed with edo, na, so4 |
PDB Entry: 4qku (more details), 2.45 Å
SCOPe Domain Sequences for d4qkud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qkud1 b.34.8.0 (D:7-133) automated matches {Burkholderia cenocepacia [TaxId: 216591]} wratldparkswietandpacdfpiqnlpfgifsdakgarrpgvalgdqivdlaalarag lvtlpagadvlaaptlnafialgrdawrsvrvqlsalfsrddatlrddaalraqvlvaqr datlhlp
Timeline for d4qkud1: