Lineage for d4qkub2 (4qku B:134-432)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1942890Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 1942891Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 1942975Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 1942976Protein automated matches [190444] (2 species)
    not a true protein
  7. 1942977Species Burkholderia cenocepacia [TaxId:216591] [257691] (1 PDB entry)
  8. 1942979Domain d4qkub2: 4qku B:134-432 [263722]
    Other proteins in same PDB: d4qkua1, d4qkub1, d4qkuc1, d4qkud1
    automated match to d4qkua2
    complexed with edo, na, so4

Details for d4qkub2

PDB Entry: 4qku (more details), 2.45 Å

PDB Description: Crystal structure of a putative hydrolase from Burkholderia cenocepacia
PDB Compounds: (B:) hydrolase

SCOPe Domain Sequences for d4qkub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qkub2 d.177.1.0 (B:134-432) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
veipgytdfysskehatnvgsmfrdpknallpnwsempigyngrassvvvsgtpvrrpng
qlklpdqerpvfgacrkldieletgfivgkgnalgepiacedaeahifgmvllndwsard
iqqweyvplgpfnskgfattispwivtldalepfrvaqpeqspqplaylrhagkhafdia
levtlraegaaeatsicrtnfrhmywtmaqqlahhtvagcntrvgdlmgsgtisgptkds
fgslleltwngkepvalngggsrtfiedgdeltlagwcqgdgyrvgfgtcagrilpars

SCOPe Domain Coordinates for d4qkub2:

Click to download the PDB-style file with coordinates for d4qkub2.
(The format of our PDB-style files is described here.)

Timeline for d4qkub2: