Lineage for d4qjia1 (4qji A:186-412)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2905091Superfamily c.72.3: CoaB-like [102645] (2 families) (S)
    combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest
  5. 2905109Family c.72.3.0: automated matches [258365] (1 protein)
    not a true family
  6. 2905110Protein automated matches [258366] (4 species)
    not a true protein
  7. 2905114Species Mycobacterium smegmatis [TaxId:246196] [258367] (1 PDB entry)
  8. 2905115Domain d4qjia1: 4qji A:186-412 [263720]
    Other proteins in same PDB: d4qjia2, d4qjib2
    automated match to d4qjib_
    complexed with ctp, mg

Details for d4qjia1

PDB Entry: 4qji (more details), 2.65 Å

PDB Description: crystal structure of the c-terminal ctp-binding domain of a phosphopantothenoylcysteine decarboxylase/phosphopantothenate- cysteine ligase with bound ctp from mycobacterium smegmatis
PDB Compounds: (A:) Phosphopantothenate--cysteine ligase

SCOPe Domain Sequences for d4qjia1:

Sequence, based on SEQRES records: (download)

>d4qjia1 c.72.3.0 (A:186-412) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dmagvkalvtaggtrepldpvrfignrssgkqgyavarvlaqrgadvtliagntaglidp
agvemvhigsatqlrdavskhapdanvlvmaaavadfrpahvaaakikkgasepssidlv
rnddvlagavraradgqlpnmraivgfaaetgdangdvlfharaklerkgcdllvvnavg
enrafevdhndgwllsadgtesalehgsktlmatrivdsiaaflksq

Sequence, based on observed residues (ATOM records): (download)

>d4qjia1 c.72.3.0 (A:186-412) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dmagvkalvtaggtrepldpvrfignrssgkqgyavarvlaqrgadvtliagntaglidp
agvemvhigsatqlrdavskhapdanvlvmaaavadfrpahvaaakikepssidlvrndd
vlagavraradgqlpnmraivgfaaetgdangdvlfharaklerkgcdllvvndgwllsa
dgtesalehgsktlmatrivdsiaaflksq

SCOPe Domain Coordinates for d4qjia1:

Click to download the PDB-style file with coordinates for d4qjia1.
(The format of our PDB-style files is described here.)

Timeline for d4qjia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qjia2