Lineage for d1bmla_ (1bml A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60664Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 60665Species Human (Homo sapiens) [TaxId:9606] [50589] (4 PDB entries)
  8. 60676Domain d1bmla_: 1bml A: [26372]
    Other proteins in same PDB: d1bmlc1, d1bmlc2, d1bmlc3, d1bmld1, d1bmld2, d1bmld3

Details for d1bmla_

PDB Entry: 1bml (more details), 2.9 Å

PDB Description: complex of the catalytic domain of human plasmin and streptokinase

SCOP Domain Sequences for d1bmla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmla_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens)}
aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
stelcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
twiegvmrnn

SCOP Domain Coordinates for d1bmla_:

Click to download the PDB-style file with coordinates for d1bmla_.
(The format of our PDB-style files is described here.)

Timeline for d1bmla_: