Lineage for d4qi9c1 (4qi9 C:1-160)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511773Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)
  8. 2511778Domain d4qi9c1: 4qi9 C:1-160 [263705]
    Other proteins in same PDB: d4qi9a2, d4qi9b2, d4qi9c2
    automated match to d4qi9a_
    complexed with mtx

Details for d4qi9c1

PDB Entry: 4qi9 (more details), 2.3 Å

PDB Description: Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate
PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d4qi9c1:

Sequence, based on SEQRES records: (download)

>d4qi9c1 c.71.1.0 (C:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Sequence, based on observed residues (ATOM records): (download)

>d4qi9c1 c.71.1.0 (C:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg
tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidathfpdyepde
wesvfsefhdadeanshsycfeilerr

SCOPe Domain Coordinates for d4qi9c1:

Click to download the PDB-style file with coordinates for d4qi9c1.
(The format of our PDB-style files is described here.)

Timeline for d4qi9c1: