SCOPe 2.05: Domain d4qi9c_: 4qi9 C:

Lineage for d4qi9c_ (4qi9 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)

8. Domain d4qi9c_: 4qi9 C: [263705]
   automated match to d4qi9a_
   complexed with mtx

Details for d4qi9c_

PDB Entry: 4qi9, 2.3 Å

PDB Description: Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate

PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d4qi9c_:

Sequence, based on SEQRES records:

>d4qi9c_ c.71.1.0 (C:) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerrgenlyfq

Sequence, based on observed residues (ATOM records):

>d4qi9c_ c.71.1.0 (C:) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg
tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidathfpdyepde
wesvfsefhdadeanshsycfeilerrgenlyfq

Timeline for d4qi9c_:

• d4qi9c_ is new in SCOPe 2.05-stable
  
• d4qi9c_ is called d4qi9c1 in SCOPe 2.06
  
• d4qi9c_ appears in the current release, SCOPe 2.08, called d4qi9c1