SCOPe 2.08: Domain d4qi9c1: 4qi9 C:1-160

Lineage for d4qi9c1 (4qi9 C:1-160)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)

8. Domain d4qi9c1: 4qi9 C:1-160 [263705]
   Other proteins in same PDB: d4qi9a2, d4qi9b2, d4qi9c2
   automated match to d4qi9a_
   complexed with mtx

Details for d4qi9c1

PDB Entry: 4qi9, 2.3 Å

PDB Description: Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate

PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d4qi9c1:

Sequence, based on SEQRES records:

>d4qi9c1 c.71.1.0 (C:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Sequence, based on observed residues (ATOM records):

>d4qi9c1 c.71.1.0 (C:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg
tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidathfpdyepde
wesvfsefhdadeanshsycfeilerr

Timeline for d4qi9c1:

• d4qi9c1 first appeared in SCOPe 2.05, called d4qi9c_
  
• d4qi9c1 appears in SCOPe 2.07