Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (27 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries) |
Domain d4qi9b1: 4qi9 B:1-160 [263704] Other proteins in same PDB: d4qi9a2, d4qi9b2, d4qi9c2 automated match to d4qi9a_ complexed with mtx |
PDB Entry: 4qi9 (more details), 2.3 Å
SCOPe Domain Sequences for d4qi9b1:
Sequence, based on SEQRES records: (download)
>d4qi9b1 c.71.1.0 (B:1-160) automated matches {Yersinia pestis [TaxId: 214092]} miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev ggdthfpdyepdewesvfsefhdadeanshsycfeilerr
>d4qi9b1 c.71.1.0 (B:1-160) automated matches {Yersinia pestis [TaxId: 214092]} miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaevggdthfpd yepdewesvfsefhdadeanshsycfeilerr
Timeline for d4qi9b1:
View in 3D Domains from other chains: (mouse over for more information) d4qi9a1, d4qi9a2, d4qi9c1, d4qi9c2 |