Lineage for d4qi9b1 (4qi9 B:1-160)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2154171Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2154172Protein automated matches [190777] (21 species)
    not a true protein
  7. 2154407Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)
  8. 2154411Domain d4qi9b1: 4qi9 B:1-160 [263704]
    Other proteins in same PDB: d4qi9a2, d4qi9b2, d4qi9c2
    automated match to d4qi9a_
    complexed with mtx

Details for d4qi9b1

PDB Entry: 4qi9 (more details), 2.3 Å

PDB Description: Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4qi9b1:

Sequence, based on SEQRES records: (download)

>d4qi9b1 c.71.1.0 (B:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerr

Sequence, based on observed residues (ATOM records): (download)

>d4qi9b1 c.71.1.0 (B:1-160) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg
tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaevggdthfpd
yepdewesvfsefhdadeanshsycfeilerr

SCOPe Domain Coordinates for d4qi9b1:

Click to download the PDB-style file with coordinates for d4qi9b1.
(The format of our PDB-style files is described here.)

Timeline for d4qi9b1: