Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (19 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries) |
Domain d4qi9b_: 4qi9 B: [263704] automated match to d4qi9a_ complexed with mtx |
PDB Entry: 4qi9 (more details), 2.3 Å
SCOPe Domain Sequences for d4qi9b_:
Sequence, based on SEQRES records: (download)
>d4qi9b_ c.71.1.0 (B:) automated matches {Yersinia pestis [TaxId: 214092]} miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev ggdthfpdyepdewesvfsefhdadeanshsycfeilerrgenlyfq
>d4qi9b_ c.71.1.0 (B:) automated matches {Yersinia pestis [TaxId: 214092]} miisliaalaadrvihlpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpg tdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaevggdthfpd yepdewesvfsefhdadeanshsycfeilerrgenlyfq
Timeline for d4qi9b_: