Lineage for d4qgkb1 (4qgk B:1-457)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140987Protein automated matches [190401] (5 species)
    not a true protein
  7. 2140988Species Human (Homo sapiens) [TaxId:9606] [189906] (18 PDB entries)
  8. 2141010Domain d4qgkb1: 4qgk B:1-457 [263701]
    Other proteins in same PDB: d4qgka2, d4qgkb2
    automated match to d4qgka_

Details for d4qgkb1

PDB Entry: 4qgk (more details), 2.1 Å

PDB Description: Structure of the Human Sjogren Larsson Syndrome enzyme fatty aldehyde dehydrogenase (FALDH)
PDB Compounds: (B:) Fatty aldehyde dehydrogenase

SCOPe Domain Sequences for d4qgkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgkb1 c.82.1.1 (B:1-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
melevrrvrqaflsgrsrplrfrlqqlealrrmvqerekdiltaiaadlcksefnvysqe
vitvlgeidfmlenlpewvtakpvkknvltmldeayiqpqplgvvliigawnypfvltiq
pligaiaagnaviikpselsentakilakllpqyldqdlyivinggveettellkqrfdh
ifytgntavgkivmeaaakhltpvtlelggkspcyidkdcdldivcrritwgkymncgqt
ciapdyilceaslqnqivwkiketvkefygenikespdyeriinlrhfkrilsllegqki
afggetdeatryiaptvltdvdpktkvmqeeifgpilpivpvknvdeainfinerekpla
lyvfshnhklikrmidetssggvtgndvimhftlnsfpfggvgssgmgayhgkhsfdtfs
hqrpcllkslkreganklryppnsqskvdwgkffllk

SCOPe Domain Coordinates for d4qgkb1:

Click to download the PDB-style file with coordinates for d4qgkb1.
(The format of our PDB-style files is described here.)

Timeline for d4qgkb1:

  • d4qgkb1 first appeared in SCOPe 2.05, called d4qgkb_

View in 3D
Domains from same chain:
(mouse over for more information)
d4qgkb2