Lineage for d4qgfb_ (4qgf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114700Species Staphylococcus aureus [TaxId:282458] [193407] (7 PDB entries)
  8. 2114709Domain d4qgfb_: 4qgf B: [263700]
    automated match to d2ccgb_
    complexed with 32b

Details for d4qgfb_

PDB Entry: 4qgf (more details), 1.83 Å

PDB Description: s.aureus tmk in complex with the potent inhibitor compound 38, 2-(3-chlorophenoxy)-3-methoxy-4-{(1r)-1-[(3s)-3-(5-methyl-2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)piperidin-1-yl]propyl}benzoic acid
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4qgfb_:

Sequence, based on SEQRES records: (download)

>d4qgfb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records): (download)

>d4qgfb_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreridqedlkfhekviegyqeiihnesqrfksvnadqplenvv
edtyqtiikyleki

SCOPe Domain Coordinates for d4qgfb_:

Click to download the PDB-style file with coordinates for d4qgfb_.
(The format of our PDB-style files is described here.)

Timeline for d4qgfb_: