Lineage for d4qfeh_ (4qfe H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836507Species Mycobacterium smegmatis [TaxId:246196] [196398] (4 PDB entries)
  8. 1836520Domain d4qfeh_: 4qfe H: [263691]
    automated match to d4qfea_
    complexed with edo, eoh, na, po4

Details for d4qfeh_

PDB Entry: 4qfe (more details), 1.95 Å

PDB Description: Crystal Structure of an Enoyl-CoA hydratase from Mycobacterium smegmatis
PDB Compounds: (H:) enoyl-coa hydratase

SCOPe Domain Sequences for d4qfeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qfeh_ c.14.1.0 (H:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
epvrierngpvttviidrpearnavngptaaalfaafeefdaddtasvavltgangtfca
gadlkafgtpeanqvhregpgpmgpsrmdlskpviaaisgyavagglelalwcdlrvvde
datmgvfcrrwgvplidggtvrlprlighsramdliltgravdaaeayaiglanrvvptg
qarqaaeelaadlarlpqqcmradrlsalhqwgesenaamdfefasi

SCOPe Domain Coordinates for d4qfeh_:

Click to download the PDB-style file with coordinates for d4qfeh_.
(The format of our PDB-style files is described here.)

Timeline for d4qfeh_: