SCOPe 2.05: Domain d1qrzd_: 1qrz D:

Lineage for d1qrzd_ (1qrz D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Plasmin(ogen), catalytic domain [50588] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50589] (8 PDB entries)

8. Domain d1qrzd_: 1qrz D: [26369]

Details for d1qrzd_

PDB Entry: 1qrz, 2 Å

PDB Description: catalytic domain of plasminogen

PDB Compounds: (D:) plasminogen

SCOPe Domain Sequences for d1qrzd_:

Sequence; same for both SEQRES and ATOM records:

>d1qrzd_ b.47.1.2 (D:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
fdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgqhfcggtlispewvltaahcl
eksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvipa
clpspnymvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqstel
caghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwie
gvlrnn

Timeline for d1qrzd_:

• d1qrzd_ first appeared (with stable ids) in SCOP 1.55
  
• d1qrzd_ appears in SCOPe 2.04
  
• d1qrzd_ appears in SCOPe 2.06
  
• d1qrzd_ appears in the current release, SCOPe 2.08