Lineage for d4qfee1 (4qfe E:2-229)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113393Species Mycobacterium smegmatis [TaxId:246196] [196398] (5 PDB entries)
  8. 2113403Domain d4qfee1: 4qfe E:2-229 [263688]
    Other proteins in same PDB: d4qfea2, d4qfee2
    automated match to d4qfea_
    complexed with edo, eoh, na, po4

Details for d4qfee1

PDB Entry: 4qfe (more details), 1.95 Å

PDB Description: Crystal Structure of an Enoyl-CoA hydratase from Mycobacterium smegmatis
PDB Compounds: (E:) enoyl-coa hydratase

SCOPe Domain Sequences for d4qfee1:

Sequence, based on SEQRES records: (download)

>d4qfee1 c.14.1.0 (E:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sepvrierngpvttviidrpearnavngptaaalfaafeefdaddtasvavltgangtfc
agadlkafgtpeanqvhregpgpmgpsrmdlskpviaaisgyavagglelalwcdlrvvd
edatmgvfcrrwgvplidggtvrlprlighsramdliltgravdaaeayaiglanrvvpt
gqarqaaeelaadlarlpqqcmradrlsalhqwgesenaamdfefasi

Sequence, based on observed residues (ATOM records): (download)

>d4qfee1 c.14.1.0 (E:2-229) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
sepvrierngpvttviidrpearnavngptaaalfaafeefdaddtasvavltgangtfc
agadlkafgtpeanqvhregpgpmgpsrmdlskpviaaisgyavagglelalwcdlrvvd
edatmgvfcrplidggtvrlprlighsramdliltgravdaaeayaiglanrvvptgqar
qaaeelaadlarlpqqcmradrlsalhqwgesenaamdfefasi

SCOPe Domain Coordinates for d4qfee1:

Click to download the PDB-style file with coordinates for d4qfee1.
(The format of our PDB-style files is described here.)

Timeline for d4qfee1: