![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.2: FMDV leader protease [54037] (2 proteins) automatically mapped to Pfam PF05408 |
![]() | Protein automated matches [254558] (3 species) not a true protein |
![]() | Species Foot-and-mouth disease virus [TaxId:73482] [260753] (1 PDB entry) |
![]() | Domain d4qbba_: 4qbb A: [263670] automated match to d1qola_ complexed with e69, k, po4 |
PDB Entry: 4qbb (more details), 1.6 Å
SCOPe Domain Sequences for d4qbba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qbba_ d.3.1.2 (A:) automated matches {Foot-and-mouth disease virus [TaxId: 73482]} meltlyngekktfysrpnnhdncwlnailqlfryveepffdwvysspenltleaikqled ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqep
Timeline for d4qbba_: