SCOPe 2.07: Domain d4qbba_: 4qbb A:

Lineage for d4qbba_ (4qbb A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.2: FMDV leader protease [54037] (2 protein domains)
   automatically mapped to Pfam PF05408

6. Protein automated matches [254558] (3 species)
   not a true protein

7. Species Foot-and-mouth disease virus [TaxId:73482] [260753] (1 PDB entry)

8. Domain d4qbba_: 4qbb A: [263670]
   automated match to d1qola_
   complexed with e69, k, po4

Details for d4qbba_

PDB Entry: 4qbb, 1.6 Å

PDB Description: structure of the foot-and-mouth disease virus leader proteinase in complex with inhibitor (n~2~-[(3s)-4-({(2r)-1-[(4-carbamimidamidobutyl)amino]-4-methyl-1-oxopentan-2-yl}amino)-3-hydroxy-4-oxobutanoyl]-l-arginyl-l-prolinamide)

PDB Compounds: (A:) Leader protease

SCOPe Domain Sequences for d4qbba_:

Sequence; same for both SEQRES and ATOM records:

>d4qbba_ d.3.1.2 (A:) automated matches {Foot-and-mouth disease virus [TaxId: 73482]}
meltlyngekktfysrpnnhdncwlnailqlfryveepffdwvysspenltleaikqled
ltglelheggppalviwnikhllhtgigtasrpsevcvvdgtdmcladfhagiflkgqeh
avfacvtsngwyaiddedfypwtpdpsdvlvfvpydqep

Timeline for d4qbba_:

• d4qbba_ first appeared in SCOPe 2.05
  
• d4qbba_ appears in SCOPe 2.06