Lineage for d4qaka_ (4qak A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912229Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 1912230Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 1912291Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 1912292Protein automated matches [190796] (4 species)
    not a true protein
  7. 1912295Species Escherichia coli [TaxId:83333] [260567] (1 PDB entry)
  8. 1912296Domain d4qaka_: 4qak A: [263669]
    automated match to d4qakb_
    complexed with 2am, gol

Details for d4qaka_

PDB Entry: 4qak (more details), 2.02 Å

PDB Description: Crystal structure of phosphoesterase
PDB Compounds: (A:) 2'-5'-RNA ligase

SCOPe Domain Sequences for d4qaka_:

Sequence, based on SEQRES records: (download)

>d4qaka_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
pqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsll
agrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpfh
phitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records): (download)

>d4qaka_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
pqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsll
agrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqspfhph
itllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d4qaka_:

Click to download the PDB-style file with coordinates for d4qaka_.
(The format of our PDB-style files is described here.)

Timeline for d4qaka_: