SCOPe 2.08: Domain d4qaka_: 4qak A:

Lineage for d4qaka_ (4qak A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [260567] (1 PDB entry)

8. Domain d4qaka_: 4qak A: [263669]
   automated match to d4qakb_
   complexed with 2am, gol

Details for d4qaka_

PDB Entry: 4qak, 2.02 Å

PDB Description: Crystal structure of phosphoesterase

PDB Compounds: (A:) 2'-5'-RNA ligase

SCOPe Domain Sequences for d4qaka_:

Sequence, based on SEQRES records:

>d4qaka_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
pqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsll
agrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpfh
phitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records):

>d4qaka_ d.61.1.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
pqrlffaidlpaeireqiihwrathfppeagrpvaadnlhltlaflgevsaekekalsll
agrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqspfhph
itllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Timeline for d4qaka_:

• d4qaka_ first appeared in SCOPe 2.05
  
• d4qaka_ appears in SCOPe 2.07