Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries) |
Domain d4qacj1: 4qac J:1-205 [263668] Other proteins in same PDB: d4qaca2, d4qacb2, d4qacc2, d4qacd2, d4qace2, d4qacf2, d4qacg2, d4qach2, d4qaci2, d4qacj2 automated match to d4alxa_ complexed with kk3, nag, po4 |
PDB Entry: 4qac (more details), 2.1 Å
SCOPe Domain Sequences for d4qacj1:
Sequence, based on SEQRES records: (download)
>d4qacj1 b.96.1.1 (J:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkg
>d4qacj1 b.96.1.1 (J:1-205) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty sccpeayedvevslnfrkkg
Timeline for d4qacj1: