Lineage for d4q9wb_ (4q9w B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1899479Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1899480Protein automated matches [190526] (20 species)
    not a true protein
  7. 1899534Species Clavularia sp. [TaxId:86521] [188532] (6 PDB entries)
  8. 1899536Domain d4q9wb_: 4q9w B: [263661]
    automated match to d4q9wa_

Details for d4q9wb_

PDB Entry: 4q9w (more details), 1 Å

PDB Description: mTFP*: a robust and versatile host protein at 1.00 A resolution
PDB Compounds: (B:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d4q9wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9wb_ d.22.1.0 (B:) automated matches {Clavularia sp. [TaxId: 86521]}
sgvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydiltta
fxnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkg
enfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakka
vklpdyhfvdhrieilnydkdynkvtvyesavarnstd

SCOPe Domain Coordinates for d4q9wb_:

Click to download the PDB-style file with coordinates for d4q9wb_.
(The format of our PDB-style files is described here.)

Timeline for d4q9wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q9wa_