SCOPe 2.08: Domain d4q9wb1: 4q9w B:2-218

Lineage for d4q9wb1 (4q9w B:2-218)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (26 species)
   not a true protein

7. Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries)

8. Domain d4q9wb1: 4q9w B:2-218 [263661]
   Other proteins in same PDB: d4q9wa2, d4q9wa3, d4q9wb2, d4q9wb3
   automated match to d4q9wa_

Details for d4q9wb1

PDB Entry: 4q9w, 1 Å

PDB Description: mTFP*: a robust and versatile host protein at 1.00 A resolution

PDB Compounds: (B:) GFP-like fluorescent chromoprotein cFP484

SCOPe Domain Sequences for d4q9wb1:

Sequence; same for both SEQRES and ATOM records:

>d4q9wb1 d.22.1.0 (B:2-218) automated matches {Clavularia sp. [TaxId: 86521]}
gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
klpdyhfvdhrieilnydkdynkvtvyesavarns

Timeline for d4q9wb1:

• d4q9wb1 first appeared in SCOPe 2.05, called d4q9wb_
  
• d4q9wb1 appears in SCOPe 2.07