Lineage for d4q9ob_ (4q9o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919043Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156
  4. 2919044Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) (S)
    the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase
  5. 2919112Family c.101.1.0: automated matches [191361] (1 protein)
    not a true family
  6. 2919113Protein automated matches [190431] (13 species)
    not a true protein
  7. 2919186Species Streptococcus pneumoniae [TaxId:171101] [260378] (2 PDB entries)
  8. 2919190Domain d4q9ob_: 4q9o B: [263660]
    Other proteins in same PDB: d4q9oa2
    automated match to d4q9oa_
    complexed with 2zw, so4

Details for d4q9ob_

PDB Entry: 4q9o (more details), 2.2 Å

PDB Description: Crystal structure of Upps + inhibitor
PDB Compounds: (B:) Isoprenyl transferase

SCOPe Domain Sequences for d4q9ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9ob_ c.101.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
qvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafstenw
trpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknnt
glilnfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdl
iirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh

SCOPe Domain Coordinates for d4q9ob_:

Click to download the PDB-style file with coordinates for d4q9ob_.
(The format of our PDB-style files is described here.)

Timeline for d4q9ob_: