![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.0: automated matches [191361] (1 protein) not a true family |
![]() | Protein automated matches [190431] (13 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:171101] [260378] (2 PDB entries) |
![]() | Domain d4q9ob_: 4q9o B: [263660] Other proteins in same PDB: d4q9oa2 automated match to d4q9oa_ complexed with 2zw, so4 |
PDB Entry: 4q9o (more details), 2.2 Å
SCOPe Domain Sequences for d4q9ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q9ob_ c.101.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]} qvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafstenw trpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknnt glilnfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdl iirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh
Timeline for d4q9ob_: