SCOPe 2.07: Domain d4q9ob_: 4q9o B:

Lineage for d4q9ob_ (4q9o B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.0: automated matches [191361] (1 protein)
   not a true family

6. Protein automated matches [190431] (8 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:171101] [260378] (2 PDB entries)

8. Domain d4q9ob_: 4q9o B: [263660]
   Other proteins in same PDB: d4q9oa2
   automated match to d4q9oa_
   complexed with 2zw, so4

Details for d4q9ob_

PDB Entry: 4q9o, 2.2 Å

PDB Description: Crystal structure of Upps + inhibitor

PDB Compounds: (B:) Isoprenyl transferase

SCOPe Domain Sequences for d4q9ob_:

Sequence; same for both SEQRES and ATOM records:

>d4q9ob_ c.101.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
qvpahigiimdgngrwakkrmqprvfghkagmealqtvtkaanklgvkvitvyafstenw
trpdqevkfimnlpvefydnyvpelhannvkiqmigetdrlpkqtfealtkaeeltknnt
glilnfalnyggraeitqalklisqdvldakinpgditeelignylftqhlpkdlrdpdl
iirtsgelrlsnflpwqgayselyftdtlwpdfdeaalqeailaynrrh

Timeline for d4q9ob_:

• d4q9ob_ first appeared in SCOPe 2.05
  
• d4q9ob_ appears in SCOPe 2.06