Lineage for d4q9ng_ (4q9n G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843062Species Chlamydia trachomatis [TaxId:1340853] [257638] (1 PDB entry)
  8. 2843069Domain d4q9ng_: 4q9n G: [263658]
    automated match to d4q9na_
    complexed with 0we, nai

Details for d4q9ng_

PDB Entry: 4q9n (more details), 1.8 Å

PDB Description: crystal structure of chlamydia trachomatis enoyl-acp reductase (fabi) in complex with nadh and afn-1252
PDB Compounds: (G:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4q9ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9ng_ c.2.1.2 (G:) automated matches {Chlamydia trachomatis [TaxId: 1340853]}
mlkidltgkiafiagigddngygwgiakmlaeagatilvgtwvpiykifsqslelgkfna
srelsngelltfakiypmdasfdtpedipqeilenkrykdlsgytvsevveqvkkhfghi
dilvhslanspeiakplldtsrkgylaalstssysfisllshfgpimnagastisltyla
smravpgygggmnaakaalesdtkvlaweagrrwgvrvntisagplasragkaigfierm
vdyyqdwaplpspmeaeqvgaaaaflvsplasaitgetlyvdhganvmgigpemf

SCOPe Domain Coordinates for d4q9ng_:

Click to download the PDB-style file with coordinates for d4q9ng_.
(The format of our PDB-style files is described here.)

Timeline for d4q9ng_: