SCOPe 2.06: Domain d4q7ra_: 4q7r A:

Lineage for d4q7ra_ (4q7r A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [258320] (4 PDB entries)

8. Domain d4q7ra_: 4q7r A: [263648]
   automated match to d3ztfa_
   complexed with act, zn

Details for d4q7ra_

PDB Entry: 4q7r, 1.4 Å

PDB Description: crystal structure of large stokes shift fluorescent protein lssmorange

PDB Compounds: (A:) LSSmOrange

SCOPe Domain Sequences for d4q7ra_:

Sequence; same for both SEQRES and ATOM records:

>d4q7ra_ d.22.1.0 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
maiikefmrfkvhmegsvnghefeiegegegrpyegfqtvklkvtkggplpfawdilspq
xskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklrgt
nfpsdgpvmqkktmgmeassermypedgalkgedklrlklkdgghytsevkttykakkpv
qlpgayivdiklditshnedytiveqyeraegrhstggmdelyk

Timeline for d4q7ra_:

• d4q7ra_ first appeared in SCOPe 2.05
  
• d4q7ra_ appears in SCOPe 2.07
  
• d4q7ra_ appears in the current release, SCOPe 2.08