| Class g: Small proteins [56992] (100 folds) |
| Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
| Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
| Protein automated matches [190772] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
| Domain d4q6fd_: 4q6f D: [263645] automated match to d4q6fa_ complexed with edo, zn |
PDB Entry: 4q6f (more details), 1.91 Å
SCOPe Domain Sequences for d4q6fd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q6fd_ g.50.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv
Timeline for d4q6fd_: