Lineage for d4q6fd_ (4q6f D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037962Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 3037963Protein automated matches [190772] (6 species)
    not a true protein
  7. 3037968Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)
  8. 3037989Domain d4q6fd_: 4q6f D: [263645]
    automated match to d4q6fa_
    complexed with edo, zn

Details for d4q6fd_

PDB Entry: 4q6f (more details), 1.91 Å

PDB Description: crystal structure of human baz2a phd zinc finger in complex with unmodified h3k4 histone peptide
PDB Compounds: (D:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d4q6fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q6fd_ g.50.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvtclvcrkgdndeflllcdgcdrgchiychrpkmeavpegdwfctvclaqqv

SCOPe Domain Coordinates for d4q6fd_:

Click to download the PDB-style file with coordinates for d4q6fd_.
(The format of our PDB-style files is described here.)

Timeline for d4q6fd_: