SCOPe 2.08: Domain d4q59a1: 4q59 A:38-153

Lineage for d4q59a1 (4q59 A:38-153)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein automated matches [191021] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)

8. Domain d4q59a1: 4q59 A:38-153 [263632]
   Other proteins in same PDB: d4q59a2, d4q59b2
   automated match to d3f7pa1

Details for d4q59a1

PDB Entry: 4q59, 2.3 Å

PDB Description: Crystal structure of plectin 1a actin-binding domain

PDB Compounds: (A:) Plectin

SCOPe Domain Sequences for d4q59a1:

Sequence; same for both SEQRES and ATOM records:

>d4q59a1 a.40.1.1 (A:38-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
derdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprekgrmrf
hklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsg

Timeline for d4q59a1:

• d4q59a1 first appeared in SCOPe 2.05
  
• d4q59a1 appears in SCOPe 2.07