Lineage for d4q2ra2 (4q2r A:103-381)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214351Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2214415Protein automated matches [226885] (5 species)
    not a true protein
  7. 2214416Species Cow (Bos taurus) [TaxId:9913] [259468] (1 PDB entry)
  8. 2214417Domain d4q2ra2: 4q2r A:103-381 [263614]
    Other proteins in same PDB: d4q2ra1, d4q2rb1
    automated match to d1g0wa2
    complexed with so4

Details for d4q2ra2

PDB Entry: 4q2r (more details), 1.65 Å

PDB Description: Structural Proteomics From Crude Native Rod Outer Segments
PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d4q2ra2:

Sequence, based on SEQRES records: (download)

>d4q2ra2 d.128.1.2 (A:103-381) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfpevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

Sequence, based on observed residues (ATOM records): (download)

>d4q2ra2 d.128.1.2 (A:103-381) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwineedhlrvismqkggnmkevftrfcngltqietlfksknyefmwnphlgyilt
cpsnlgtglragvhiklphlgkhekfpevlkrlrlqkrgggvfdvsnadrlgfsevelvq
mvvdgvklliemeqrleqgqaiddlmpaqk

SCOPe Domain Coordinates for d4q2ra2:

Click to download the PDB-style file with coordinates for d4q2ra2.
(The format of our PDB-style files is described here.)

Timeline for d4q2ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q2ra1