SCOPe 2.08: Domain d4q2ra1: 4q2r A:6-102

Lineage for d4q2ra1 (4q2r A:6-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [259466] (1 PDB entry)

8. Domain d4q2ra1: 4q2r A:6-102 [263613]
   Other proteins in same PDB: d4q2ra2, d4q2rb2
   automated match to d1g0wa1
   complexed with so4

Details for d4q2ra1

PDB Entry: 4q2r, 1.65 Å

PDB Description: Structural Proteomics From Crude Native Rod Outer Segments

PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d4q2ra1:

Sequence, based on SEQRES records:

>d4q2ra1 a.83.1.0 (A:6-102) automated matches {Cow (Bos taurus) [TaxId: 9913]}
shntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgvdnpg
hpyimtvgcvagdeesydvfkelfdpiiedrhggykp

Sequence, based on observed residues (ATOM records):

>d4q2ra1 a.83.1.0 (A:6-102) automated matches {Cow (Bos taurus) [TaxId: 9913]}
shnlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgvdnpgh
pyimtvgcvagdeesydvfkelfdpiiedrhggykp

Timeline for d4q2ra1:

• d4q2ra1 first appeared in SCOPe 2.05
  
• d4q2ra1 appears in SCOPe 2.07