Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries) Uniprot P00749 156-178,179-424 |
Domain d1lmw.2: 1lmw C:,D: [26361] complexed with 0gj |
PDB Entry: 1lmw (more details), 2.5 Å
SCOPe Domain Sequences for d1lmw.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1lmw.2 b.47.1.2 (C:,D:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgqktlrpXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca qpsrtiqticlpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqph yygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy trvshflpwirshtkee
Timeline for d1lmw.2:
View in 3D Domains from other chains: (mouse over for more information) d1lmw.1, d1lmw.1, d1lmw.1, d1lmw.1 |