SCOP 1.73: Domain d1lmw.2: 1lmw C:,D:

Lineage for d1lmw.2 (1lmw C:,D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (36 PDB entries)

8. Domain d1lmw.2: 1lmw C:,D: [26361]

Details for d1lmw.2

PDB Entry: 1lmw, 2.5 Å

PDB Description: lmw u-pa structure complexed with egrcmk (glu-gly-arg chloromethyl ketone)

PDB Compounds: (C:) urokinase-type plasminogen activator, (D:) urokinase-type plasminogen activator

SCOP Domain Sequences for d1lmw.2:

Sequence; same for both SEQRES and ATOM records:

>g1lmw.2 b.47.1.2 (C:,D:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgqktlrpXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfidy
pkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrca
qpsrtiqticlpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqph
yygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvy
trvshflpwirshtkee

Timeline for d1lmw.2:

• d1lmw.2 first appeared (with stable ids) in SCOP 1.55
  
• d1lmw.2 appears in SCOP 1.71
  
• d1lmw.2 appears in SCOP 1.75
  
• d1lmw.2 appears in the current release, SCOPe 2.08