Lineage for d4q2nd1 (4q2n D:362-460)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2056895Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2057006Domain d4q2nd1: 4q2n D:362-460 [263609]
    Other proteins in same PDB: d4q2na2, d4q2nb2, d4q2nc2, d4q2nd2, d4q2ne2, d4q2nf2
    automated match to d4q2na_
    complexed with edo

Details for d4q2nd1

PDB Entry: 4q2n (more details), 2 Å

PDB Description: inadl pdz3 in complex with a phage-derived peptide
PDB Compounds: (D:) InaD-like protein

SCOPe Domain Sequences for d4q2nd1:

Sequence, based on SEQRES records: (download)

>d4q2nd1 b.36.1.0 (D:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etynvelvrkdgqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndkivav
dgvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi

Sequence, based on observed residues (ATOM records): (download)

>d4q2nd1 b.36.1.0 (D:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etynvelvrkqslgirivgyvgasgiyvksiipgsaayhnghiqvndkivavdgvniqgf
anhdvvevlrnagqvvhltlvrrgggwfldi

SCOPe Domain Coordinates for d4q2nd1:

Click to download the PDB-style file with coordinates for d4q2nd1.
(The format of our PDB-style files is described here.)

Timeline for d4q2nd1: