SCOPe 2.07: Domain d4q2nb1: 4q2n B:362-460

Lineage for d4q2nb1 (4q2n B:362-460)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d4q2nb1: 4q2n B:362-460 [263607]
   Other proteins in same PDB: d4q2na2, d4q2nb2, d4q2nc2, d4q2nd2, d4q2ne2, d4q2nf2
   automated match to d4q2na_
   complexed with edo

Details for d4q2nb1

PDB Entry: 4q2n, 2 Å

PDB Description: inadl pdz3 in complex with a phage-derived peptide

PDB Compounds: (B:) InaD-like protein

SCOPe Domain Sequences for d4q2nb1:

Sequence, based on SEQRES records:

>d4q2nb1 b.36.1.0 (B:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etynvelvrkdgqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndkivav
dgvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi

Sequence, based on observed residues (ATOM records):

>d4q2nb1 b.36.1.0 (B:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etynvelvrkqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndkivavdg
vniqgfanhdvvevlrnagqvvhltlvrrgggwfldi

Timeline for d4q2nb1:

• d4q2nb1 first appeared in SCOPe 2.05, called d4q2nb_
  
• d4q2nb1 appears in SCOPe 2.06
  
• d4q2nb1 appears in the current release, SCOPe 2.08