Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries) |
Domain d4q2nb1: 4q2n B:362-460 [263607] Other proteins in same PDB: d4q2na2, d4q2nb2, d4q2nc2, d4q2nd2, d4q2ne2, d4q2nf2 automated match to d4q2na_ complexed with edo |
PDB Entry: 4q2n (more details), 2 Å
SCOPe Domain Sequences for d4q2nb1:
Sequence, based on SEQRES records: (download)
>d4q2nb1 b.36.1.0 (B:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]} etynvelvrkdgqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndkivav dgvniqgfanhdvvevlrnagqvvhltlvrrgggwfldi
>d4q2nb1 b.36.1.0 (B:362-460) automated matches {Human (Homo sapiens) [TaxId: 9606]} etynvelvrkqslgirivgyvgtshtgeasgiyvksiipgsaayhnghiqvndkivavdg vniqgfanhdvvevlrnagqvvhltlvrrgggwfldi
Timeline for d4q2nb1: