SCOP 1.55: Domain d1lmw.1: 1lmw A:,B:

Lineage for d1lmw.1 (1lmw A:,B:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (6 PDB entries)

8. Domain d1lmw.1: 1lmw A:,B: [26360]

Details for d1lmw.1

PDB Entry: 1lmw, 2.5 Å

PDB Description: lmw u-pa structure complexed with egrcmk (glu-gly-arg chloromethyl ketone)

SCOP Domain Sequences for d1lmw.1:

Sequence; same for both SEQRES and ATOM records:

>g1lmw.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens)}
cgqktlrprXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirshtkee

Timeline for d1lmw.1:

• d1lmw.1 appears in SCOP 1.57
  
• d1lmw.1 appears in the current release, SCOPe 2.08