SCOPe 2.06: Domain d4q14a_: 4q14 A:

Lineage for d4q14a_ (4q14 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (7 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [257596] (1 PDB entry)

8. Domain d4q14a_: 4q14 A: [263597]
   automated match to d3qvaa_
   complexed with cit, cl

Details for d4q14a_

PDB Entry: 4q14, 1.7 Å

PDB Description: crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis

PDB Compounds: (A:) 5-hydroxyisourate hydrolase

SCOPe Domain Sequences for d4q14a_:

Sequence; same for both SEQRES and ATOM records:

>d4q14a_ b.3.4.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
mgklsthvldtahgtpaaamrvelyriaasgtpellkrvvtnldgrtdapllsgdemrtg
iyelqfhvaeyfegrgaelahepfldlipirfgiadedgnyhvpllvspwsystyrgs

Timeline for d4q14a_:

• d4q14a_ first appeared in SCOPe 2.05
  
• d4q14a_ appears in SCOPe 2.07
  
• d4q14a_ appears in the current release, SCOPe 2.08