![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
![]() | Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
![]() | Protein automated matches [190651] (8 species) not a true protein |
![]() | Species Brucella melitensis [TaxId:359391] [257596] (1 PDB entry) |
![]() | Domain d4q14a_: 4q14 A: [263597] automated match to d3qvaa_ complexed with cit, cl |
PDB Entry: 4q14 (more details), 1.7 Å
SCOPe Domain Sequences for d4q14a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q14a_ b.3.4.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]} mgklsthvldtahgtpaaamrvelyriaasgtpellkrvvtnldgrtdapllsgdemrtg iyelqfhvaeyfegrgaelahepfldlipirfgiadedgnyhvpllvspwsystyrgs
Timeline for d4q14a_: