Lineage for d4py8j2 (4py8 J:107-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2353406Domain d4py8j2: 4py8 J:107-212 [263587]
    Other proteins in same PDB: d4py8a1, d4py8a2, d4py8b_, d4py8j1
    automated match to d1dn0a2
    complexed with mli, nag

Details for d4py8j2

PDB Entry: 4py8 (more details), 2.91 Å

PDB Description: Crystal structure of Fab 3.1 in complex with the 1918 influenza virus hemagglutinin
PDB Compounds: (J:) antibody 3.1 light chain

SCOPe Domain Sequences for d4py8j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4py8j2 b.1.1.2 (J:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4py8j2:

Click to download the PDB-style file with coordinates for d4py8j2.
(The format of our PDB-style files is described here.)

Timeline for d4py8j2: