SCOPe 2.01: Domain d1c5z.1: 1c5z A:,B:

Lineage for d1c5z.1 (1c5z A:,B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (52 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d1c5z.1: 1c5z A:,B: [26358]
   complexed with bam, flc

Details for d1c5z.1

PDB Entry: 1c5z, 1.85 Å

PDB Description: structural basis for selectivity of a small molecule, s1-binding, sub- micromolar inhibitor of urokinase type plasminogen activator

PDB Compounds: (A:) protein (urokinase-type plasminogen activator), (B:) protein (urokinase-type plasminogen activator)

SCOPe Domain Sequences for d1c5z.1:

Sequence; same for both SEQRES and ATOM records:

>g1c5z.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqktXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfid
ypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrc
aqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqqp
hyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgv
ytrvshflpwirsht

Timeline for d1c5z.1:

• d1c5z.1 first appeared (with stable ids) in SCOP 1.55
  
• d1c5z.1 appears in SCOP 1.75
  
• d1c5z.1 appears in SCOPe 2.02
  
• d1c5z.1 appears in the current release, SCOPe 2.08