Lineage for d4pw5f_ (4pw5 F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2077175Family b.122.1.12: SRA domain-like [159368] (2 protein domains)
    Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA
  6. 2077202Protein automated matches [191193] (1 species)
    not a true protein
  7. 2077203Species Human (Homo sapiens) [TaxId:9606] [189495] (3 PDB entries)
  8. 2077213Domain d4pw5f_: 4pw5 F: [263578]
    automated match to d2zkea_
    protein/DNA complex

Details for d4pw5f_

PDB Entry: 4pw5 (more details), 2.2 Å

PDB Description: structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I
PDB Compounds: (F:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d4pw5f_:

Sequence, based on SEQRES records: (download)

>d4pw5f_ b.122.1.12 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevdr
gdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragkp
vrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwt
segiersrrlclrlqypagy

Sequence, based on observed residues (ATOM records): (download)

>d4pw5f_ b.122.1.12 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevdr
gdeftytgsgsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgrkis
kyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrlclr
lqypagy

SCOPe Domain Coordinates for d4pw5f_:

Click to download the PDB-style file with coordinates for d4pw5f_.
(The format of our PDB-style files is described here.)

Timeline for d4pw5f_: