SCOPe 2.08: Domain d4pw5f_: 4pw5 F:

Lineage for d4pw5f_ (4pw5 F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.12: SRA domain-like [159368] (2 proteins)
   Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNA

6. Protein automated matches [191193] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189495] (3 PDB entries)

8. Domain d4pw5f_: 4pw5 F: [263578]
   automated match to d2zkea_
   protein/DNA complex

Details for d4pw5f_

PDB Entry: 4pw5, 2.2 Å

PDB Description: structure of UHRF2-SRA in complex with a 5hmC-containing DNA, complex I

PDB Compounds: (F:) E3 ubiquitin-protein ligase UHRF2

SCOPe Domain Sequences for d4pw5f_:

Sequence, based on SEQRES records:

>d4pw5f_ b.122.1.12 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevdr
gdeftytgsggknlagnkrigapsadqtltnmnralalncdaplddkigaesrnwragkp
vrvirsfkgrkiskyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwt
segiersrrlclrlqypagy

Sequence, based on observed residues (ATOM records):

>d4pw5f_ b.122.1.12 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpsnhygpipgipvgstwrfrvqvseagvhrphvggihgrsndgayslvlaggfadevdr
gdeftytgsgsadqtltnmnralalncdaplddkigaesrnwragkpvrvirsfkgrkis
kyapeegnrydgiykvvkywpeissshgflvwryllrrddvepapwtsegiersrrlclr
lqypagy

Timeline for d4pw5f_:

• d4pw5f_ first appeared in SCOPe 2.05
  
• d4pw5f_ appears in SCOPe 2.07