SCOPe 2.08: Domain d4pvca_: 4pvc A:

Lineage for d4pvca_ (4pvc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [232746] (5 PDB entries)

8. Domain d4pvca_: 4pvc A: [263574]
   automated match to d4pvcb_

Details for d4pvca_

PDB Entry: 4pvc, 2 Å

PDB Description: Crystal structure of yeast methylglyoxal/ isovaleraldehyde reductase Gre2

PDB Compounds: (A:) NADPH-dependent methylglyoxal reductase GRE2

SCOPe Domain Sequences for d4pvca_:

Sequence; same for both SEQRES and ATOM records:

>d4pvca_ c.2.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msvfvsgangfiaqhivdlllkedykvigsarsqekaenlteafgnnpkfsmevvpdisk
ldafdhvfqkhgkdikivlhtaspfcfditdserdllipavngvkgilhsikkyaadsve
rvvltssyaavfdmakendksltfneeswnpatwescqsdpvnaycgskkfaekaawefl
eenrdsvkfeltavnpvyvfgpqmfdkdvkkhlntscelvnslmhlspedkipelfggyi
dvrdvakahlvafqkretigqrlivsearftmqdvldilnedfpvlkgnipvgkpgsgat
hntlgatldnkkskkllgfkfrnlketiddtasqilkfegri

Timeline for d4pvca_:

• d4pvca_ first appeared in SCOPe 2.05
  
• d4pvca_ appears in SCOPe 2.07