SCOPe 2.05: Domain d4pusa_: 4pus A:

Lineage for d4pusa_ (4pus A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza a virus [TaxId:381518] [260563] (1 PDB entry)

8. Domain d4pusa_: 4pus A: [263573]
   automated match to d1aa7a_

Details for d4pusa_

PDB Entry: 4pus, 2.2 Å

PDB Description: Crystal Structure of Influenza A Virus Matrix Protein M1

PDB Compounds: (A:) matrix protein 1

SCOPe Domain Sequences for d4pusa_:

Sequence; same for both SEQRES and ATOM records:

>d4pusa_ a.95.1.1 (A:) automated matches {Influenza a virus [TaxId: 381518]}
hslltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeialsys
agalascmgliynrmgavttevafglvcatceqiadsq

Timeline for d4pusa_:

• d4pusa_ is new in SCOPe 2.05-stable
  
• d4pusa_ is called d4pusa1 in SCOPe 2.06
  
• d4pusa_ appears in the current release, SCOPe 2.08, called d4pusa1