SCOPe 2.08: Domain d4pusa1: 4pus A:2-158

Lineage for d4pusa1 (4pus A:2-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein automated matches [190930] (4 species)
   not a true protein

7. Species Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [260563] (5 PDB entries)

8. Domain d4pusa1: 4pus A:2-158 [263573]
   Other proteins in same PDB: d4pusa2
   automated match to d1aa7a_

Details for d4pusa1

PDB Entry: 4pus, 2.2 Å

PDB Description: Crystal Structure of Influenza A Virus Matrix Protein M1

PDB Compounds: (A:) matrix protein 1

SCOPe Domain Sequences for d4pusa1:

Sequence; same for both SEQRES and ATOM records:

>d4pusa1 a.95.1.1 (A:2-158) automated matches {Influenza A virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
slltevetyvlsivpsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeialsysa
galascmgliynrmgavttevafglvcatceqiadsq

Timeline for d4pusa1:

• d4pusa1 first appeared in SCOPe 2.05, called d4pusa_
  
• d4pusa1 appears in SCOPe 2.07