![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries) |
![]() | Domain d4puoc2: 4puo C:430-554 [263572] Other proteins in same PDB: d4puoa1, d4puoa3, d4puob_, d4puoc1, d4puoc3, d4puod_ automated match to d2ykna2 protein/DNA complex; protein/RNA complex; complexed with nvp |
PDB Entry: 4puo (more details), 2.9 Å
SCOPe Domain Sequences for d4puoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4puoc2 c.55.3.0 (C:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d4puoc2: