Lineage for d4puoc1 (4puo C:1-429)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3017298Protein automated matches [190211] (7 species)
    not a true protein
  7. 3017329Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225820] (18 PDB entries)
  8. 3017343Domain d4puoc1: 4puo C:1-429 [263571]
    Other proteins in same PDB: d4puoa2, d4puoa3, d4puob_, d4puoc2, d4puoc3, d4puod_
    automated match to d2ykna1
    protein/DNA complex; protein/RNA complex; complexed with nvp

Details for d4puoc1

PDB Entry: 4puo (more details), 2.9 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with RNA/DNA and Nevirapine
PDB Compounds: (C:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4puoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4puoc1 e.8.1.2 (C:1-429) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d4puoc1:

Click to download the PDB-style file with coordinates for d4puoc1.
(The format of our PDB-style files is described here.)

Timeline for d4puoc1: