SCOPe 2.05: Domain d4puoa2: 4puo A:430-554

Lineage for d4puoa2 (4puo A:430-554)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (18 PDB entries)

8. Domain d4puoa2: 4puo A:430-554 [263570]
   Other proteins in same PDB: d4puoa1, d4puob_, d4puoc1, d4puod_
   automated match to d2ykna2
   protein/DNA complex; protein/RNA complex; complexed with nvp

Details for d4puoa2

PDB Entry: 4puo, 2.9 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with RNA/DNA and Nevirapine

PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4puoa2:

Sequence; same for both SEQRES and ATOM records:

>d4puoa2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d4puoa2:

• d4puoa2 is new in SCOPe 2.05-stable
  
• d4puoa2 appears in SCOPe 2.06
  
• d4puoa2 appears in the current release, SCOPe 2.08